PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF073600100CFD_t1
Common NameTRAES_3BF073600100CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 437aa    MW: 48351.5 Da    PI: 7.1954
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF073600100CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM67.63.4e-21131388128
                      NAM   8 hPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k....kvkaeekewyfFskrdkkyatgkrknratk..sgyWkat 86 
                              hP++ el++ yL  +++++  +  e+i+++d+y+++P +L  k    + +++ek wyfFs+ + k+ +g+rk r+ +  +g W++ 
  TRAES3BF073600100CFD_t1  13 HPSEPELIKSYLLGRITKDL-SW-EFIHDADVYTADPASLTgKflaaSDDSGEKVWYFFSPVRPKNVRGQRKARTLEsgAGCWHSE 96 
                              8**************98876.45.68**************854554433347789*******************76633778**** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                +k+v + +g+ vg ++ + f  +++ +  +t W+m e rl
  TRAES3BF073600100CFD_t1  97 AGTKAVEDGDGHRVGYRQFFSFVYKHNGRRIRTGWLMVELRL 138
                              **********************999999999********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100530.4176158IPR003441NAC domain
SuperFamilySSF1019415.62E-3113158IPR003441NAC domain
PfamPF023659.6E-1213138IPR003441NAC domain
PfamPF008045.9E-30286374IPR006011Syntaxin, N-terminal domain
SuperFamilySSF476612.28E-22286394IPR010989t-SNARE
SMARTSM003972.9E-17334401IPR000727Target SNARE coiled-coil homology domain
Gene3DG3DSA:1.20.5.1101.2E-29337431No hitNo description
CDDcd158488.74E-27338400No hitNo description
PROSITE profilePS5019217.801339401IPR000727Target SNARE coiled-coil homology domain
PROSITE patternPS009140345384IPR006012Syntaxin/epimorphin, conserved site
PfamPF057391.1E-15377427IPR000727Target SNARE coiled-coil homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006886Biological Processintracellular protein transport
GO:0016192Biological Processvesicle-mediated transport
GO:0061025Biological Processmembrane fusion
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0009504Cellular Componentcell plate
GO:0009506Cellular Componentplasmodesma
GO:0009524Cellular Componentphragmoplast
GO:0012505Cellular Componentendomembrane system
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0005484Molecular FunctionSNAP receptor activity
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MATSCPVSSA SRHPSEPELI KSYLLGRITK DLSWEFIHDA DVYTADPASL TGKFLAASDD  60
SGEKVWYFFS PVRPKNVRGQ RKARTLESGA GCWHSEAGTK AVEDGDGHRV GYRQFFSFVY  120
KHNGRRIRTG WLMVELRLDR QQGEKKPSDL VLCKIYLTPR APSSSAHATR RPDGEETGGK  180
RKNDCQSPDE APPVRQCRSH NLPEATSSSN VVTAVMDDDV RSARTTQPAN SAPASSMMQS  240
PRERLSYPPL AAEGEAAAVF PAESSASATR IMAPPYFVLP SSDYSRQEYK DTVERRYYTL  300
TGEVPEDEVI ERIISEGRGE EIMSAAVAEH GKGAVLAALN EIQDRHDAAR EVERSLLELH  360
QVFLDMAVIV EAQGEKINDI AHHVSNARDY VHSGNKELGK AREHQRGSRK CLCIGIILLL  420
LLILIVIVPI ATSLRRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-161315627166NAC domain-containing protein 19
3swm_B3e-161315627166NAC domain-containing protein 19
3swm_C3e-161315627166NAC domain-containing protein 19
3swm_D3e-161315627166NAC domain-containing protein 19
3swp_A3e-161315627166NAC domain-containing protein 19
3swp_B3e-161315627166NAC domain-containing protein 19
3swp_C3e-161315627166NAC domain-containing protein 19
3swp_D3e-161315627166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A077S2J50.0A0A077S2J5_WHEAT; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40112972
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27410.28e-19NAC family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]